Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chili Garlic Chicken Liver with Fresh Veg

Spicy, savory chicken liver stir-fried in a bold sambal goreng sauce with tomato and cucumber on the side. Ready in under 20 minutes — pure weeknight heat.

Total time
18 min
Servings
2
Calories
220
Protein
22g
Chili Garlic Chicken Liver with Fresh Veg
quickboldindonesianchickentendercrispyweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken liver dry with paper towels. Cut into 1-inch pieces.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering.

  3. Step 3

    Add garlic and cook 30 seconds until fragrant, then add sambal paste and stir for 1 minute.

  4. Step 4

    Add chicken liver pieces and cook, stirring often, for 6–7 minutes until no pink remains.

  5. Step 5

    Squeeze lime juice over the liver, season with salt and pepper, then plate immediately.

  6. Step 6

    Serve hot with tomato and cucumber slices on the side.

Tools you’ll need

  • large skillet, 10–12 inch
  • paper towels
  • cutting board
  • knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.