Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Chili Liver & Rice with Duck Egg

Tender chicken liver seared in a fiery sambal glaze, plated with jasmine rice, a runny duck egg, and quick stir-fried shrimp vegetables. A complete Indonesian dinner in under 20 minutes.

Total time
18 min
Servings
2
Calories
485
Protein
38g
Crispy Chili Liver & Rice with Duck Egg
satisfyingboldindonesianchickencrispytendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high. Pat liver dry, season with salt and pepper.

  2. Step 2

    Sear liver 2–3 minutes per side without moving — edges should caramelize. Transfer to a plate.

  3. Step 3

    Add shallots to the same pan, cook 90 seconds until fragrant. Stir in sambal and cook 60 seconds more.

  4. Step 4

    Add shrimp and vegetables. Stir-fry 3–4 minutes until shrimp turn pink and vegetables soften slightly.

  5. Step 5

    Return liver to the pan, toss gently to coat in sambal. Cook 1 minute more until warmed through.

  6. Step 6

    Divide rice between bowls. Top with liver mixture, set a duck egg alongside, and serve hot.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • cutting board
  • chef's knife
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.