Back to recipes
Chili Lime Popcorn
Crispy popcorn coated in a tangy-spicy chili-lime seasoning. Ready in minutes with just five pantry staples—the perfect snack for movie night or quick cravings.
- Total time
- 10 min
- Servings
- 4
- Calories
- 85
- Protein
- 2g
casualquickveganvegetariandairy-freecrispycrunchyweeknight
Ingredients
5 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Pop popcorn in oil using stovetop method, covered pot, or air popper until kernels slow to 2–3 seconds apart.
Step 2
Transfer popped corn to a large bowl. Drizzle with lime juice while still warm.
Step 3
Sprinkle chili powder, lime zest, and salt evenly over popcorn.
Step 4
Toss vigorously until every piece is coated. Serve immediately.
Tools you’ll need
- large heavy-bottomed pot with lid (stovetop method) or air popper
- large mixing bowl
- microplane or fine grater (for lime zest)
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
