CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Puchka with Tangy Tamarind Water

Hollow, shattered puffed shells filled with spiced potatoes, chickpeas, and fresh mint, dunked in tart tamarind water. The ultimate Indian street snack that's crunchy, tangy, and dangerously addictive.

Total time
25 min
Servings
2
Calories
185
Protein
6g
Crispy Puchka with Tangy Tamarind Water
casualfreshindianvegetarianveganchickpeascrispycrunchy

Ingredients

  • 12 pieces puchka shells (store-bought, fried)
  • ¾ cup boiled potatoes, cubed small
  • ½ cup canned chickpeas, drained and rinsed
  • 2 tbsp tamarind paste
  • 2 whole green chilies, minced
  • ¼ cup fresh mint leaves, chopped

Instructions

  1. 1

    Whisk tamarind paste with 1 cup water, 1/2 tsp salt, and 1/4 tsp black pepper until smooth. This is your tangy water.

  2. 2

    Toss cubed potatoes with chickpeas, green chilies, and most of the mint in a small bowl.

  3. 3

    Gently crack or poke a small hole in the top of each puchka shell.

  4. 4

    Stuff each shell with 1 tbsp of the potato-chickpea mixture.

  5. 5

    Set 2–3 filled puchkas on a plate and pour 3–4 tbsp tamarind water over and around them.

  6. 6

    Garnish with reserved mint and eat immediately before shells soften.

Tools you’ll need

  • small bowl
  • whisk or fork
  • small spoon for filling

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.