Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chipotle Beef Sopes — Crispy & Tangy

Crispy fried masa cups loaded with shredded chipotle beef, topped with crema and pickled onions. Ready in 25 minutes — weeknight dinner that feels like a taquería.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Chipotle Beef Sopes — Crispy & Tangy
casualsatisfyingmexicanbeefcrispytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix masa harina with 1 cup warm water and a pinch of salt until it forms a soft, Play-Doh-like dough.

  2. Step 2

    Divide dough into 6 portions. Press each between plastic wrap into a thin disc, then pinch edges up to form a shallow cup.

  3. Step 3

    Heat oil in a skillet over medium-high. Fry each masa cup until golden and crispy, 2–3 minutes per side. Drain on paper towels.

  4. Step 4

    In the same skillet, brown beef over high heat, breaking it apart with a spoon, 4–5 minutes. Chop chipotles, add to beef with 2 tbsp adobo sauce, and stir 30 seconds.

  5. Step 5

    Toss red onion with lime juice and a pinch of salt. Let sit while beef finishes.

  6. Step 6

    Fill each masa cup with chipotle beef, top with crema and pickled onions. Serve hot.

Tools you’ll need

  • medium bowl
  • plastic wrap
  • 12-inch skillet
  • wooden spoon
  • paper towels
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.