Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chocolate Banana Bread Bites

No-bake chocolate banana bites that taste like banana bread in snack form. Ready in minutes with just bananas, chocolate, and pantry staples.

Total time
10 min
Servings
4
Calories
210
Protein
5g
Chocolate Banana Bread Bites
quicksatisfyingvegetarianchewycrispyBreadsnackappetizer

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice bananas into 1/4-inch-thick rounds.

  2. Step 2

    Combine chocolate chips, peanut butter, and salt in a microwave-safe bowl.

  3. Step 3

    Microwave in 30-second bursts, stirring between, until melted and smooth.

  4. Step 4

    Dip banana rounds halfway into chocolate, then roll the chocolate side in graham cracker crumbs.

  5. Step 5

    Place on parchment paper and refrigerate 5 minutes until chocolate sets.

  6. Step 6

    Serve cold or at room temperature.

Tools you’ll need

  • microwave-safe bowl
  • microwave
  • spoon
  • parchment paper

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.