Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Peanut Butter Oatmeal Bars

No-bake peanut butter and oat bars that come together in minutes. Chewy, satisfying, and perfect for grabbing on the go.

Total time
10 min
Servings
8
Calories
312
Protein
9g
Peanut Butter Oatmeal Bars
quicksatisfyingvegetarianchewycrumblyBreakfastcookiesnack

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Line an 8×8-inch baking pan with parchment paper, leaving overhang on two sides.

  2. Step 2

    Combine peanut butter, honey, and butter in a medium bowl and stir until smooth.

  3. Step 3

    Fold in oats and salt until no dry spots remain and the mixture looks compact.

  4. Step 4

    Press the mixture firmly into the pan, using a spatula to pack it down evenly.

  5. Step 5

    Refrigerate for 5 minutes, then lift out using the parchment overhang and cut into 8 bars.

Tools you’ll need

  • 8×8-inch baking pan
  • parchment paper
  • medium bowl
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.