Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chocolate Covered Frozen Banana Bites

Ripe bananas sliced, frozen, and dipped in melted chocolate for an easy no-bake snack. Ready to eat in minutes with zero cleanup.

Total time
12 min
Servings
4
Calories
185
Protein
1g
Chocolate Covered Frozen Banana Bites
simpleindulgentvegetariancreamycrispysnackappetizersnack

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel bananas and slice into 1-inch rounds on a cutting board.

  2. Step 2

    Arrange banana slices on a parchment-lined tray in a single layer.

  3. Step 3

    Freeze for 5 minutes until firm enough to handle but not rock-solid.

  4. Step 4

    Heat chocolate chips and coconut oil in a microwave-safe bowl in 30-second pulses, stirring between each, until just melted and smooth.

  5. Step 5

    Dip each frozen banana slice into melted chocolate, letting excess drip off, then place back on the parchment.

  6. Step 6

    Sprinkle with salt if desired. Freeze for 2 minutes until chocolate sets.

  7. Step 7

    Serve immediately or store in an airtight container in the freezer up to 1 week.

Tools you’ll need

  • cutting board
  • knife
  • parchment paper
  • sheet tray
  • microwave-safe bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.