Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Churro French Toast with Berries

Thick bread soaked in cinnamon-sugar egg batter, pan-fried until golden and crispy. Serve warm with fresh berries for a breakfast that tastes like dessert.

Total time
15 min
Servings
2
Calories
310
Protein
10g
Churro French Toast with Berries
indulgentcomfortamericanvegetarianeggscrispyfluffyweeknight

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk eggs with sugar and cinnamon in a shallow bowl until combined.

  2. Step 2

    Heat oil in a skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Dip bread slices into the egg mixture, coating both sides until saturated.

  4. Step 4

    Fry bread 2–3 minutes per side until edges are golden brown and crispy.

  5. Step 5

    Transfer to a plate and top with fresh berries.

Tools you’ll need

  • shallow bowl
  • whisk
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.