Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cinnamon Sugar Churros With Chocolate & Dulce de Leche

Crispy fried churros dusted in cinnamon sugar, served with warm chocolate sauce and dulce de leche for dipping. Ready in under 20 minutes with a piping bag and one skillet.

Total time
18 min
Servings
4
Calories
420
Protein
4g
Cinnamon Sugar Churros With Chocolate & Dulce de Leche
indulgentsimplespanishvegetariancrispyfluffydessertparty

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and water in a bowl until a thick, paste-like dough forms with no lumps.

  2. Step 2

    Heat 2 inches of neutral oil in a deep skillet to 375°F, ~8 minutes. Oil should shimmer and a pinch of flour should sizzle immediately.

  3. Step 3

    Transfer dough to a piping bag fitted with a large star tip. Pipe 4-inch lengths into hot oil, using scissors to cut. Fry in batches without crowding.

  4. Step 4

    Fry until golden brown and crispy, ~2 minutes per side. Use a slotted spoon to turn once halfway through. Drain on paper towels.

  5. Step 5

    Mix cinnamon and sugar in a shallow dish. Toss warm churros to coat generously while still warm.

  6. Step 6

    Warm chocolate sauce and dulce de leche in separate small bowls. Serve churros with both dips on the side.

Tools you’ll need

  • medium mixing bowl
  • deep skillet or Dutch oven
  • deep-fry or candy thermometer
  • piping bag with large star tip
  • kitchen scissors
  • slotted spoon
  • paper towels
  • shallow dish for cinnamon-sugar mixture
  • two small bowls for dips

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.