Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Cinnamon Sugar Churros with Hot Chocolate

Crispy-outside, pillowy-inside churros piped straight into hot oil, tossed in cinnamon sugar, and served with silky melted chocolate for dipping. Restaurant-quality in 15 minutes, no fancy equipment needed.

Total time
15 min
Servings
4
Calories
420
Protein
5g
15-Min Cinnamon Sugar Churros with Hot Chocolate
indulgentsimplespanishvegetariancrispyfluffydessertweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour with 2 tbsp sugar, a pinch of salt, and 1 tsp cinnamon in a bowl. Add 1 cup boiling water slowly, stirring until a thick paste forms.

  2. Step 2

    Heat oil in a heavy pot to 375°F (use a thermometer). Transfer dough to a churrera or piping bag fitted with a large star tip.

  3. Step 3

    Carefully pipe 4-inch lengths of dough directly into hot oil in batches—they'll float and brown in 1.5-2 minutes per side.

  4. Step 4

    Remove churros with a slotted spoon and drain on paper towels. Toss immediately with remaining 1 tbsp sugar and 0.5 tsp cinnamon.

  5. Step 5

    Heat chocolate and cream in a small pot over low heat, stirring until smooth and pourable.

  6. Step 6

    Serve churros warm with chocolate dip alongside.

Tools you’ll need

  • medium bowl
  • heavy pot (at least 3 quarts)
  • candy / frying thermometer
  • churrera or large star-tip piping bag
  • slotted spoon
  • paper towels
  • small pot for chocolate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.