Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Classic Brioche French Toast

Golden, custard-soaked brioche slices cooked until crispy outside and creamy inside. Ready in 15 minutes and perfect for a simple breakfast or brunch.

Total time
15 min
Servings
2
Calories
298
Protein
9g
Classic Brioche French Toast
comfortindulgentfrenchvegetarianeggscrispycreamyfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Crack the 2 eggs into a shallow bowl (like a cereal bowl). Pour in 0.33 cup milk, 1 tablespoon sugar, and 0.5 teaspoon vanilla extract.

  2. Step 2

    Whisk the egg mixture with a fork for about 20 seconds until the color is uniform and no streaks of white remain.

  3. Step 3

    Place a 10-inch skillet over medium heat and add 1.5 tablespoons butter. Wait about 60 seconds until the butter melts completely and smells nutty.

  4. Step 4

    Pick up one brioche slice with your fingers, dip it into the egg mixture for 1 full second on each side (do not soak), and place it in the hot skillet.

  5. Step 5

    Repeat with the remaining 3 brioche slices, placing them in the skillet so they do not touch each other.

  6. Step 6

    Cook for 2 to 3 minutes until the bottom of each slice turns golden brown (the color of caramel candy) and the edges look darker and crispy.

  7. Step 7

    Using a thin metal spatula, slide it under each slice and flip it over in one quick motion.

  8. Step 8

    Cook the second side for 1 to 2 minutes until it also turns golden brown and feels slightly firm when you press the center with your finger.

  9. Step 9

    Transfer the 4 slices to a serving plate. Top with fresh berries, maple syrup, powdered sugar, or whipped cream as desired.

Tools you’ll need

  • shallow bowl (cereal bowl size)
  • fork
  • 10-inch skillet
  • thin metal spatula
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.