Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Classic French Toast

Thick slices of bread soaked in a custardy egg-milk mixture, then pan-fried until golden and crispy. Serve warm with butter, maple syrup, or fresh berries for a comforting breakfast.

Total time
20 min
Servings
2
Calories
385
Protein
11g
Classic French Toast
comfortcozyamericanvegetarianeggscrispyfluffysoft

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Crack the 2 eggs into a wide, shallow bowl (such as a soup bowl or baking dish). Pour in 0.33 cup milk, 0.5 teaspoon vanilla extract, 0.25 teaspoon cinnamon, and a small pinch of salt and pepper.

  2. Step 2

    Whisk the egg mixture with a fork until the eggs are fully broken up and no white streaks remain, about 15 seconds. The mixture should look pale yellow and uniform.

  3. Step 3

    Place a 12-inch nonstick skillet or griddle on the stovetop and turn the heat to medium. Let it warm for 30 seconds, then add 1 tablespoon butter and let it melt and coat the pan evenly.

  4. Step 4

    Pick up one bread slice, dip one side into the egg mixture for 1 second (count 'one-one-thousand'), then flip it and dip the other side for 1 second. The bread should be wet but not dripping.

  5. Step 5

    Lay the coated bread slice on the hot buttered pan. Repeat with the remaining 3 slices, arranging them in the pan so they do not touch or overlap.

  6. Step 6

    Cook the French toast without moving it for 2 to 3 minutes, until the bottom is golden brown and feels firm when you press it gently with a spatula.

  7. Step 7

    Using a thin metal spatula, slide underneath one slice and flip it gently, supporting it from underneath so it does not break. Repeat for the other 3 slices.

  8. Step 8

    Cook the second side for 1 to 2 minutes, until it is also golden brown and the bread springs back slightly when poked.

  9. Step 9

    Transfer the hot French toast to a serving plate using the spatula. Serve immediately with butter, maple syrup, fresh berries, powdered sugar, or your favorite toppings.

Tools you’ll need

  • large shallow bowl or baking dish
  • fork
  • 12-inch nonstick skillet or griddle
  • thin metal spatula
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.