Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Clay Pot Rice with Crispy Edges

Vietnamese comfort in one skillet: cooked rice gets layered with savory toppings, soy sauce, and a knob of butter, then crisped hard until the bottom shatters. Serve with a cracked egg on top and a drizzle of fish sauce—pure TikTok gold.

Total time
18 min
Servings
2
Calories
385
Protein
9g
20-Min Clay Pot Rice with Crispy Edges
comfortsatisfyingvietnameseeggscrispytenderweeknightrice

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a 10-inch nonstick or cast iron skillet over medium-high until a drop of water sizzles immediately.

  2. Step 2

    Add butter, then press the rice into the skillet in a single even layer, breaking up clumps with a spatula.

  3. Step 3

    Drizzle soy sauce over the rice, sprinkle scallions on top, and don't stir—let it sit and crisp, 5-6 minutes.

  4. Step 4

    Push rice aside to make two small wells, crack an egg into each, cover with a lid or foil, and cook until whites set, 3-4 minutes.

  5. Step 5

    Drizzle fish sauce over the eggs and rice, then slide onto a plate and serve immediately.

Tools you’ll need

  • 10-inch nonstick or cast iron skillet
  • spatula
  • lid or foil cover

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.