Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Coconut Crusted French Toast

Crispy coconut-coated French toast with custardy centers and a hint of vanilla. Ready in under 20 minutes for a showstopping breakfast that tastes indulgent but requires just one pan.

Total time
20 min
Servings
2
Calories
425
Protein
11g
Coconut Crusted French Toast
indulgentcozyamericanvegetarianeggscrispyfluffycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk eggs, milk, and vanilla together in a shallow bowl until combined and frothy.

  2. Step 2

    Spread shredded coconut on a plate in an even layer.

  3. Step 3

    Dip each bread slice into egg mixture, coating both sides — 2 seconds per side.

  4. Step 4

    Coat both sides of each dipped slice generously with coconut, pressing gently.

  5. Step 5

    Heat butter in a 12-inch nonstick skillet over medium-high until foaming.

  6. Step 6

    Pan-fry French toast 3 minutes per side until coconut is golden and edges firm.

  7. Step 7

    Transfer to plates and drizzle with maple syrup or honey. Serve immediately.

Tools you’ll need

  • shallow bowl
  • whisk
  • plate
  • 12-inch nonstick skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.