Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Coconut Laksa with Prawns

Silky coconut curry broth loaded with tender prawns, noodles, and fresh herbs — ready in under 20 minutes using a laksa paste shortcut. One pot, restaurant-level flavor.

Total time
20 min
Servings
4
Calories
420
Protein
28g
20-Min Coconut Laksa with Prawns
comfortboldmalaysianshrimpsilkytenderweeknightsoup

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large pot over medium-high. Stir in laksa paste until fragrant, about 1 minute.

  2. Step 2

    Pour in coconut milk and fish stock, stirring to combine. Bring to a simmer, then add prawns.

  3. Step 3

    Cook prawns until opaque and firm, 3–4 minutes. Do not overcook or they'll turn rubbery.

  4. Step 4

    Add noodles and bok choy. Simmer until noodles are tender and greens are wilted, about 3 minutes.

  5. Step 5

    Squeeze lime juice into the pot. Taste and adjust salt or heat with extra laksa paste if needed.

  6. Step 6

    Ladle into bowls and top generously with fresh cilantro and Thai basil.

Tools you’ll need

  • large pot (3-quart or larger)
  • wooden spoon
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.