Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Coconut Seafood Vatapá

Silky coconut-peanut sauce with shrimp and white fish in 10 minutes—no traditional slow braise needed. Serve over rice or with crusty bread to soak up every drop.

Total time
15 min
Servings
4
Calories
385
Protein
42g
Coconut Seafood Vatapá
comfortsatisfyingbrazilianshrimpfishsilkytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp olive oil in a large skillet over medium-high heat until shimmering, about 60 seconds.

  2. Step 2

    Add diced bell pepper and cook, stirring, until softened and edges start to brown, about 3 minutes.

  3. Step 3

    Pour coconut milk into the skillet and stir in peanut butter and chili flakes until smooth.

  4. Step 4

    Add shrimp and fish, season with salt and pepper, and bring to a gentle simmer over medium heat.

  5. Step 5

    Cook without stirring for 4 minutes until shrimp are pink and fish is opaque throughout.

  6. Step 6

    Squeeze half a fresh lime over the top and serve in bowls over white rice.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • cutting board
  • knife
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.