Custrd is out on the App Store — Download it free →
Back to recipes

Cod Fritters with Potatoes and Broccoli

Crispy golden cod fritters served with tender potatoes and broccoli, finished with fresh herbs and toasted nuts. A quick, satisfying meal that's ready in about 20 minutes.

Total time
20 min
Servings
2
Calories
450
Protein
35g
Cod Fritters with Potatoes and Broccoli
comfortingquickPortuguesepescatarianfishcrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil the 400g potatoes in salted water until fork-tender, about 15 minutes. Add the 300g broccoli for the last 3 minutes, then drain and set aside.

  2. Step 2

    In a bowl, flake the 300g cod and mix with 2 eggs, 50g flour, and chopped 15g parsley until a thick batter forms.

  3. Step 3

    Heat oil in a pan over medium-high. Drop spoonfuls of batter and fry until golden and cooked through, about 3 minutes per side.

  4. Step 4

    Serve the fritters with the potatoes and broccoli, sprinkled with extra parsley and toasted nuts if you have them.

Tools you’ll need

  • large pot
  • frying pan
  • mixing bowl
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.