Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cottage Cheese Bowl with Honey

A 2-minute snack of creamy cottage cheese drizzled with honey and topped with crunchy granola. Sweet, satisfying, and no cooking required.

Total time
5 min
Servings
1
Calories
280
Protein
18g
Cottage Cheese Bowl with Honey
quicksimplevegetariancheesecreamycrunchyMain coursesnack

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Scoop 1 cup of cottage cheese into a bowl, spreading it evenly across the bottom and sides so it fills the bowl completely.

  2. Step 2

    Drizzle 1.5 tablespoons of honey directly over the cottage cheese in a thin zigzag pattern, covering as much surface area as you can.

  3. Step 3

    Sprinkle 0.25 cup of granola evenly over the honey-drizzled cottage cheese, breaking up any large clumps as you go.

  4. Step 4

    Scatter 0.5 cup of fresh berries on top in a single layer, distributing them evenly across the bowl.

  5. Step 5

    Eat immediately while the granola is still crunchy and the honey is warm and liquid.

Tools you’ll need

  • bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.