Back to recipes
Cottage Cheese Toast with Honey
Creamy cottage cheese spread on warm toast, drizzled with honey and topped with a pinch of flaky salt. A simple, protein-rich breakfast that's ready in minutes.
- Total time
- 10 min
- Servings
- 2
- Calories
- 215
- Protein
- 12g
simplefreshvegetariancheesecreamycrispyweeknightbrunch
Ingredients
5 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Toast bread until golden brown and crispy on both sides.
Step 2
Spread 1/3 cup cottage cheese evenly onto each warm slice of toast.
Step 3
Drizzle 1 tbsp honey over each toast.
Step 4
Sprinkle salt and black pepper over the top. Serve immediately.
Tools you’ll need
- toaster or toaster oven
- knife
- small spoon
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
