Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Whipped Ricotta Toast with Hot Honey

Creamy whipped ricotta spread on toasted bread, drizzled with spicy hot honey and fresh herbs. A breakfast or snack that tastes fancy but takes 10 minutes.

Total time
10 min
Servings
2
Calories
285
Protein
12g
Whipped Ricotta Toast with Hot Honey
simpleelegantitalianvegetariancheesecreamycrispyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toast bread until golden and crispy, about 2–3 minutes per side.

  2. Step 2

    Whisk ricotta with lemon zest, lemon juice, and a pinch of salt until light and fluffy.

  3. Step 3

    Spread whipped ricotta generously on each warm toast slice.

  4. Step 4

    Drizzle hot honey over the ricotta until it pools slightly at the edges.

  5. Step 5

    Scatter fresh herbs and flake salt on top. Serve immediately while bread is still warm.

Tools you’ll need

  • toaster or toaster oven
  • whisk or fork
  • small bowl
  • plate or cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.