Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Country Ham and Eggs

Crispy slices of salty country ham paired with perfectly cooked eggs in one skillet. A classic breakfast that's ready in under 15 minutes.

Total time
12 min
Servings
2
Calories
285
Protein
24g
Country Ham and Eggs
casualsimpleamericanporkcrispytenderweeknightmain-dish

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place a 10-inch skillet over medium-high heat and wait 1 minute until the bottom feels hot when you hold your hand 2 inches above it.

  2. Step 2

    Lay the ham slices flat in the hot skillet in a single layer, slightly overlapping if needed.

  3. Step 3

    Cook the ham for 2 minutes until the edges begin to curl and the surface turns light golden brown.

  4. Step 4

    Flip each ham slice over with tongs and cook for 1 minute more until the second side is light golden.

  5. Step 5

    Push the ham to the outer edge of the skillet and lower the heat to medium.

  6. Step 6

    Add the butter to the empty center of the skillet and swirl it around with a spoon for 20 seconds until it melts and smells nutty.

  7. Step 7

    Crack the 4 eggs one at a time directly into the melted butter, spacing them evenly around the skillet.

  8. Step 8

    Sprinkle the salt and pepper evenly over the eggs, then cover the skillet with a lid or large plate.

  9. Step 9

    Cook covered for 3 to 4 minutes until the whites turn opaque and solid but the yolks still jiggle slightly when you gently shake the pan.

  10. Step 10

    Slide the ham and eggs onto a plate, arranging the ham around the eggs.

Tools you’ll need

  • 10-inch skillet with lid or large plate to cover
  • tongs
  • spoon
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.