Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crawfish Mac & Cheese

Creamy, buttery crawfish mac finished with a Cajun kick — cooked in one skillet in under 15 minutes. Serve with the green salad and potato salad from your plate for a complete Cajun dinner.

Total time
20 min
Servings
4
Calories
642
Protein
48g
20-Min Crawfish Mac & Cheese
comfortindulgentcajunshrimpcreamytenderweeknightdinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil pasta in salted water until al dente, about 8 minutes. Reserve 1 cup pasta water before draining.

  2. Step 2

    While pasta cooks, melt butter in a large skillet over medium heat. Add crawfish and Cajun seasoning, stirring gently for 2 minutes until fragrant.

  3. Step 3

    Pour in cream and bring to a bare simmer. Add shredded cheddar in handfuls, stirring until melted and smooth, about 3 minutes.

  4. Step 4

    Stir in drained pasta and 0.5 cup pasta water. Cook 2 minutes until sauce coats every piece; add more pasta water if too thick.

  5. Step 5

    Squeeze lemon over the top. Taste and adjust seasoning with salt and pepper.

  6. Step 6

    Serve hot, garnished with chopped scallions. Serve with the green salad and potato salad on the side.

Tools you’ll need

  • large pot (for pasta)
  • large skillet (12-inch)
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.