Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Crawfish Mac and Cheese

Creamy one-pan pasta loaded with crawfish, sharp cheddar, and a kick of Cajun spice. Ready in 18 minutes—no bake required.

Total time
18 min
Servings
4
Calories
658
Protein
42g
Spicy Crawfish Mac and Cheese
comfortindulgentcajunshrimpcreamytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil pasta in salted water until al dente, about 8 minutes. Reserve 1 cup pasta water, then drain.

  2. Step 2

    In the same pot, melt butter over medium heat. Add crawfish and Cajun seasoning, stir for 1 minute until fragrant.

  3. Step 3

    Pour in milk and bring to a gentle simmer, stirring occasionally, about 2 minutes.

  4. Step 4

    Remove from heat. Stir in cheddar until melted and smooth, about 1 minute.

  5. Step 5

    Return pasta to the pot. Toss well, adding pasta water a splash at a time until the sauce coats each piece.

  6. Step 6

    Taste and adjust seasoning with salt, pepper, and extra Cajun spice if needed. Serve hot.

Tools you’ll need

  • large pot
  • wooden spoon or whisk
  • measuring cups
  • measuring spoons
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.