Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Chicken Vol-au-Vent Cups

Frozen puff pastry shells filled with tender chicken, mushrooms, and creamy sauce—a weeknight take on the French classic. Ready in 20 minutes, zero patience required.

Total time
20 min
Servings
4
Calories
510
Protein
28g
Creamy Chicken Vol-au-Vent Cups
elegantcomfortfrenchchickencreamytenderflakyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bake pastry shells at 400°F for 12 minutes until puffed and golden.

  2. Step 2

    Heat butter in a skillet over medium-high. Sauté mushrooms and shallot until golden, ~4 minutes.

  3. Step 3

    Pour in wine and scrape up any browned bits. Simmer until reduced by half, ~1 minute.

  4. Step 4

    Add cream, chicken, thyme, salt, and pepper. Stir gently and simmer until sauce coats the back of a spoon, ~2 minutes.

  5. Step 5

    Spoon filling into warm pastry cups. Serve immediately.

Tools you’ll need

  • baking sheet
  • 12-inch skillet
  • wooden spoon
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.