Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Minute Creamy Chicken Vol-au-Vents

Buttery puff pastry cups filled with tender chicken in a silky cream sauce—restaurant-fancy but ready in minutes. Swap rotisserie chicken for homemade to cut cooking time in half.

Total time
20 min
Servings
2
Calories
520
Protein
28g
20-Minute Creamy Chicken Vol-au-Vents
elegantindulgentfrenchchickencreamytenderflakyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bake vol-au-vents according to package directions (usually 15–18 min at 400°F).

  2. Step 2

    Heat butter in a medium skillet over medium heat until foaming, ~1 minute.

  3. Step 3

    Add shredded chicken, cream, and broth. Stir gently until simmering, ~2 minutes.

  4. Step 4

    Fold in tarragon and season with salt and pepper to taste. Cook 1 more minute.

  5. Step 5

    Remove vol-au-vents from oven. Spoon cream chicken into each shell and serve hot.

Tools you’ll need

  • baking sheet
  • medium skillet
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.