Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Creamy Egg Custard Cups

No-bake silky custard in espresso cups, ready in minutes. Sweetened condensed milk does the heavy lifting—just whisk, chill, and serve with espresso.

Total time
15 min
Servings
4
Calories
248
Protein
4g
15-Min Creamy Egg Custard Cups
elegantsimplechinesevegetarianeggssilkysmoothcreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk egg yolks, sweetened condensed milk, evaporated milk, vanilla, and salt until completely smooth and pale, about 2 minutes.

  2. Step 2

    Pour custard mixture evenly into four small cups or ramekins, filling each halfway.

  3. Step 3

    Chill for at least 10 minutes, or until set to a silky custard consistency.

  4. Step 4

    Serve each custard cup alongside a shot of hot espresso for dipping or sipping.

Tools you’ll need

  • whisk or fork
  • bowl
  • four small cups or espresso cups (3-4 oz)
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.