Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Min Espresso Custard Tarts

No-bake custard tarts filled with silky egg custard and topped with a shot of espresso. Ready in 5 minutes, no oven needed.

Total time
5 min
Servings
4
Calories
185
Protein
4g
5-Min Espresso Custard Tarts
elegantsimplechinesevegetarianeggssilkysmoothflaky

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk egg yolks, condensed milk, and vanilla until the mixture is pale and smooth.

  2. Step 2

    Pour custard mixture evenly into each tartlet shell until three-quarters full.

  3. Step 3

    Refrigerate tarts for 3 minutes while espresso cools to room temperature.

  4. Step 4

    Top each tart with 1 tbsp cooled espresso, letting it pool slightly on the surface.

  5. Step 5

    Dust lightly with cocoa powder if desired. Serve immediately or chill up to 1 hour.

Tools you’ll need

  • small whisk or fork
  • small bowl
  • spoon or small ladle
  • refrigerator

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.