Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Garlic Penne

Silky garlic cream coats tender penne in under 20 minutes — no fancy technique, just butter, cream, and garlic working together. Finish with sharp parmesan and you've got a weeknight pasta that tastes like you tried.

Total time
18 min
Servings
2
Calories
520
Protein
16g
Creamy Garlic Penne
comfortsimpleitalianvegetariancreamytenderweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil penne in salted water until al dente, about 10 minutes; reserve 1/2 cup pasta water before draining.

  2. Step 2

    Melt 2 tbsp butter in the same pot over medium, add minced garlic, and cook 45 seconds until fragrant.

  3. Step 3

    Pour in cream, stir to combine, and simmer 2 minutes until slightly thickened.

  4. Step 4

    Return cooked penne to the pot, add parmesan, and toss to coat, adding pasta water 1 tbsp at a time if sauce feels too thick.

  5. Step 5

    Season with salt and black pepper, then serve immediately while hot.

Tools you’ll need

  • large pot
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.