CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Creamy Mushroom Tortellini Skillet

Tender tortellini, sautéed mushrooms, and fresh asparagus tossed in a silky cream sauce in one skillet, ready in 15 minutes. Pure comfort, zero fuss.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Creamy Mushroom Tortellini Skillet
comfortsimpleitalianvegetarianvegetariancreamytenderweeknight

Ingredients

  • 1 lb tortellini
  • 8 oz mushrooms, sliced
  • 8 oz asparagus, cut into 2-inch pieces
  • 1 cup heavy cream

Instructions

  1. 1

    Boil salted water in a large skillet, add tortellini, and cook until they float, about 4 minutes.

  2. 2

    Push tortellini to the side, add mushrooms and asparagus to the skillet with a splash of oil.

  3. 3

    Sauté until mushrooms soften and asparagus turns bright green, about 4 minutes.

  4. 4

    Pour cream over everything, stir gently until tortellini coats, season with salt and pepper to taste.

  5. 5

    Warm through for 1 minute, then serve hot.

Tools you’ll need

  • large skillet

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.