Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Mushroom Tortellini Skillet

Tender tortellini, sautéed mushrooms, and fresh asparagus tossed in a silky cream sauce in one skillet, ready in 15 minutes. Pure comfort, zero fuss.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Creamy Mushroom Tortellini Skillet
comfortsimpleitalianvegetarianvegetariancreamytenderweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet, add tortellini, and cook until they float, about 4 minutes.

  2. Step 2

    Push tortellini to the side, add mushrooms and asparagus to the skillet with a splash of oil.

  3. Step 3

    Sauté until mushrooms soften and asparagus turns bright green, about 4 minutes.

  4. Step 4

    Pour cream over everything, stir gently until tortellini coats, season with salt and pepper to taste.

  5. Step 5

    Warm through for 1 minute, then serve hot.

Tools you’ll need

  • large skillet

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.