Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Green Tallarines

Peruvian-style spinach pasta with a vibrant herb-and-cheese sauce, ready in under 20 minutes. Bright, herbaceous, and deeply satisfying.

Total time
18 min
Servings
2
Calories
520
Protein
18g
Creamy Green Tallarines
freshsimpleperuvianvegetariancheesecreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet or pot. Add pasta and cook until al dente, ~10 minutes. Reserve 1 cup pasta water, then drain.

  2. Step 2

    In the same skillet, heat 2 tbsp olive oil over medium. Add minced garlic and cook 30 seconds until fragrant.

  3. Step 3

    Add spinach and fresh herbs. Stir until spinach wilts, about 1 minute. Add evaporated milk and stir to combine.

  4. Step 4

    Return cooked pasta to the skillet. Crumble queso fresco over the top and toss gently, adding pasta water 1/4 cup at a time until sauce coats noodles.

  5. Step 5

    Season with salt and pepper to taste. Serve immediately while hot and creamy.

Tools you’ll need

  • large skillet or 3-quart pot
  • colander
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.