Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Gemelli al Pesto Rosso

Silky roasted red pepper and tomato pesto coats tender gemelli pasta in this vibrant vegetarian dinner. Ready in under 30 minutes with just a few pantry staples.

Total time
25 min
Servings
4
Calories
610
Protein
18g
Gemelli al Pesto Rosso
freshsimpleitalianvegetarianvegetariancreamytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of salted water to a boil. Add gemelli and cook until al dente, ~9 minutes.

  2. Step 2

    While pasta cooks, combine roasted red peppers, sun-dried tomatoes, garlic, pine nuts, and olive oil in a food processor.

  3. Step 3

    Pulse until the sauce reaches a chunky-smooth consistency, ~20 seconds.

  4. Step 4

    Transfer pesto to a large bowl and stir in half the parmesan. Taste and adjust salt and pepper.

  5. Step 5

    Drain pasta and reserve 1/2 cup cooking water. Add pasta to pesto and toss gently.

  6. Step 6

    Loosen with reserved pasta water if needed; sauce should coat each piece lightly.

  7. Step 7

    Divide between bowls and top with remaining parmesan. Serve hot.

Tools you’ll need

  • large pot
  • food processor
  • large bowl
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.