Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Mussels in 15 Minutes

Fresh mussels steamed in a silky white wine and cream sauce with shallots and garlic. Belgian-style comfort that feels fancy but comes together in one pot.

Total time
15 min
Servings
2
Calories
385
Protein
28g
Creamy Mussels in 15 Minutes
elegantindulgentbelgianshrimptendercreamyweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp butter in a large pot over medium-high. Add shallot and cook 90 seconds until fragrant.

  2. Step 2

    Pour in white wine and bring to a simmer. Add mussels, cover, and steam 5-7 minutes until shells open.

  3. Step 3

    Remove mussels with a slotted spoon into bowls; discard any that didn't open. Stir cream into broth.

  4. Step 4

    Simmer sauce 2 minutes until slightly thickened. Squeeze lemon juice in and season with salt and pepper.

  5. Step 5

    Pour cream sauce over mussels. Garnish with parsley and serve immediately.

Tools you’ll need

  • 12-inch pot with lid
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.