Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Polenta with Mushrooms & Sage

Silky polenta stirred with butter and cheese, topped with sautéed mushrooms and crispy sage. A cozy Italian-inspired dinner that tastes like comfort.

Total time
18 min
Servings
2
Calories
385
Protein
14g
Creamy Polenta with Mushrooms & Sage
comfortwholesomeitalianvegetarianvegetariancreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring milk and broth to a simmer in a large skillet over medium heat, stirring occasionally.

  2. Step 2

    Slowly pour polenta into the simmering liquid while stirring constantly to avoid lumps.

  3. Step 3

    Reduce heat to medium-low and cook, stirring frequently, until polenta pulls away from the pan sides, ~10 minutes.

  4. Step 4

    While polenta cooks, sauté mushrooms in a separate skillet over medium-high heat with a pinch of salt until golden, ~5 minutes.

  5. Step 5

    Stir butter, Parmesan, and a pinch of salt and pepper into the cooked polenta until smooth and glossy.

  6. Step 6

    Divide polenta between bowls, top with mushrooms and crispy sage, drizzle with olive oil, and serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • separate medium skillet (10-inch)
  • wooden spoon
  • grater (for Parmesan)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.