CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Creamy Polenta with Mushrooms & Sage

Silky polenta stirred with butter and cheese, topped with sautéed mushrooms and crispy sage. A cozy Italian-inspired dinner that tastes like comfort.

Total time
18 min
Servings
2
Calories
385
Protein
14g
Creamy Polenta with Mushrooms & Sage
comfortwholesomeitalianvegetarianvegetariancreamytenderweeknight

Ingredients

  • 1 cup whole milk
  • 1.5 cups vegetable broth
  • ½ cup polenta (cornmeal)
  • 8 oz mushrooms (cremini or button), sliced
  • ½ cup Parmesan cheese, grated
  • 8 leaves fresh sage leaves

Instructions

  1. 1

    Bring milk and broth to a simmer in a large skillet over medium heat, stirring occasionally.

  2. 2

    Slowly pour polenta into the simmering liquid while stirring constantly to avoid lumps.

  3. 3

    Reduce heat to medium-low and cook, stirring frequently, until polenta pulls away from the pan sides, ~10 minutes.

  4. 4

    While polenta cooks, sauté mushrooms in a separate skillet over medium-high heat with a pinch of salt until golden, ~5 minutes.

  5. 5

    Stir butter, Parmesan, and a pinch of salt and pepper into the cooked polenta until smooth and glossy.

  6. 6

    Divide polenta between bowls, top with mushrooms and crispy sage, drizzle with olive oil, and serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • separate medium skillet (10-inch)
  • wooden spoon
  • grater (for Parmesan)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.