Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Fish & Mushy Peas

Frozen fish fillets crisped in a hot skillet, paired with buttery smashed peas and crispy oven chips. British seaside comfort in 12 minutes.

Total time
12 min
Servings
2
Calories
485
Protein
38g
Crispy Fish & Mushy Peas
comfortcasualbritishfishcrispycreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Start the oven chips according to package directions (usually 400°F, 20 min). Set a timer.

  2. Step 2

    Boil the peas in salted water for 3 minutes until tender. Drain and return to the pot.

  3. Step 3

    Mash the peas with butter, salt, and pepper until creamy. Stir in malt vinegar. Set aside and keep warm.

  4. Step 4

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 1 minute.

  5. Step 5

    Place fish fillets in the pan skin-side up. Pan-fry 4 minutes without moving until the bottom is golden and crispy.

  6. Step 6

    Flip the fillets and cook 2 minutes until the flesh is opaque and flakes easily. Season with salt and pepper.

  7. Step 7

    Plate the mushy peas, top with crispy fish, and serve with hot chips on the side.

Tools you’ll need

  • large skillet (10–12 inch)
  • small saucepan
  • wooden spoon or masher
  • slotted spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.