Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Arepas with Avocado & Cheese

Golden, fried corn cakes stuffed with creamy avocado and melty cheese. These Venezuelan-Colombian classics are crispy outside, soft inside, and ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
485
Protein
8g
Crispy Arepas with Avocado & Cheese
satisfyingcasualcolombianvegetariancheesecrispycreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix arepa flour with warm water and salt until a smooth, thick dough forms. Let rest 3 minutes.

  2. Step 2

    Mash avocado in a small bowl with a pinch of salt and black pepper.

  3. Step 3

    Divide dough into 4 equal balls. Flatten each into a disc, add a spoonful of avocado and cheese to the center, then seal and reshape into a flat cake.

  4. Step 4

    Heat oil in a 10-inch skillet over medium-high until it shimmers, about 90 seconds.

  5. Step 5

    Slide arepas into hot oil and fry 3–4 minutes per side until deep golden brown and crispy.

  6. Step 6

    Transfer to a plate lined with paper towels. Serve hot.

Tools you’ll need

  • 10-inch skillet
  • small bowl
  • measuring cups
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.