Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Feta Burek

Phyllo sheets layered with a savory feta-and-herb filling, then pan-fried until golden and crispy. A weeknight take on the Balkan classic—no rolling required.

Total time
20 min
Servings
2
Calories
410
Protein
14g
Crispy Feta Burek
satisfyingcasualbalkanvegetariancheesecrispycreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix feta, dill, scallions, and the egg in a bowl. Season with black pepper.

  2. Step 2

    Lay 2 phyllo sheets on a work surface, overlapping slightly into a rough 8x10 rectangle.

  3. Step 3

    Spread one-third of the filling across the phyllo, leaving a 1-inch border. Fold long sides inward, then roll tightly from one end. Repeat with remaining phyllo and filling to make 3 rolls.

  4. Step 4

    Heat oil in a 12-inch skillet over medium heat until it shimmers, about 90 seconds.

  5. Step 5

    Place burek rolls seam-side down in the skillet. Fry 3-4 minutes per side until deep golden and crispy, turning once.

  6. Step 6

    Transfer to a plate lined with paper towels. Serve hot, optionally with yogurt or hot sauce on the side.

Tools you’ll need

  • mixing bowl
  • 12-inch skillet
  • paper towels
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.