CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Feta Burek

Phyllo sheets layered with a savory feta-and-herb filling, then pan-fried until golden and crispy. A weeknight take on the Balkan classic—no rolling required.

Total time
20 min
Servings
2
Calories
410
Protein
14g
Crispy Feta Burek
satisfyingcasualbalkanvegetariancheesecrispycreamyweeknight

Ingredients

  • 6 sheets phyllo dough sheets
  • 200 g feta cheese, crumbled
  • ¼ cup fresh dill or parsley, chopped
  • 2 scallions scallions, chopped
  • 1 large egg eggs
  • 3 tbsp olive oil
  • ¼ tsp black pepper to taste

Instructions

  1. 1

    Mix feta, dill, scallions, and the egg in a bowl. Season with black pepper.

  2. 2

    Lay 2 phyllo sheets on a work surface, overlapping slightly into a rough 8x10 rectangle.

  3. 3

    Spread one-third of the filling across the phyllo, leaving a 1-inch border. Fold long sides inward, then roll tightly from one end. Repeat with remaining phyllo and filling to make 3 rolls.

  4. 4

    Heat oil in a 12-inch skillet over medium heat until it shimmers, about 90 seconds.

  5. 5

    Place burek rolls seam-side down in the skillet. Fry 3-4 minutes per side until deep golden and crispy, turning once.

  6. 6

    Transfer to a plate lined with paper towels. Serve hot, optionally with yogurt or hot sauce on the side.

Tools you’ll need

  • mixing bowl
  • 12-inch skillet
  • paper towels
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.