Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Banana Fritters

Golden, caramelized banana fritters coated in a light rice-flour batter and fried until edges curl. Served warm with a sweet drizzle, these are pure Vietnamese comfort in under 25 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
3g
Crispy Banana Fritters
indulgentcomfortvietnamesevegetariandairy-freecrispysoftweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel bananas and slice them diagonally into 0.5-inch-thick pieces.

  2. Step 2

    Whisk rice flour, tapioca starch, and a pinch of salt in a bowl until combined.

  3. Step 3

    Pour sparkling water into the flour mixture and stir until you have a thin, smooth batter with no lumps.

  4. Step 4

    Heat oil in a deep skillet to 350°F (175°C) — water flicked into the pan should sizzle immediately without smoking.

  5. Step 5

    Working in batches, dip banana slices into batter, tap off excess, and slide into hot oil. Fry 2–3 minutes per side until deep golden brown and edges curl slightly.

  6. Step 6

    Lift fritters onto a paper towel. Drizzle warm condensed milk over the top and serve immediately.

Tools you’ll need

  • medium bowl
  • whisk
  • deep skillet or heavy pot
  • instant-read thermometer
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.