Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Bean & Cheese Memelas

Thick, chewy corn cakes topped with refried beans, melty cheese, and pickled jalapeños. Ready in 15 minutes — the TikTok version of this Oaxacan street favorite.

Total time
15 min
Servings
2
Calories
420
Protein
12g
Crispy Bean & Cheese Memelas
comfortcasualmexicanvegetariancheesecrispychewymelty

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix masa harina with warm water until a soft, thick dough forms. Let rest 2 minutes.

  2. Step 2

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Scoop 3 tbsp dough into your palm, flatten into a thick oval cake, and slide into the hot oil.

  4. Step 4

    Cook 3–4 minutes per side without moving until edges turn golden and crispy.

  5. Step 5

    Spread warm refried beans on each memela. Top with cheese, jalapeños, and a drizzle of their brine.

  6. Step 6

    Serve warm. Repeat with remaining dough to make 4 memelas total.

Tools you’ll need

  • 12-inch skillet
  • mixing bowl
  • measuring cups and spoons
  • spatula or slotted turner

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.