Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Beef Kroketten

Dutch-style beef croquettes with a golden, crunchy exterior and creamy beef filling. Pan-fried until crispy and served with mustard for dipping.

Total time
25 min
Servings
4
Calories
385
Protein
18g
Crispy Beef Kroketten
comfortindulgentdutchbeefcrispycreamyweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Brown ground beef in a skillet over medium-high, breaking it up as it cooks, until no pink remains, about 5 minutes.

  2. Step 2

    Melt butter in the same skillet, sprinkle flour over, and stir constantly for 1 minute until it smells nutty.

  3. Step 3

    Pour milk in slowly while whisking to avoid lumps. Stir in cooked beef and mustard. Cook until thick and pulling from the sides, 2 minutes.

  4. Step 4

    Spread mixture on a plate and refrigerate for 10 minutes until cool enough to shape.

  5. Step 5

    Form 8 cylinders from the beef mixture. Beat the egg in a bowl, then roll each cylinder in egg, then in breadcrumbs.

  6. Step 6

    Pan-fry kroketten in a skillet with oil over medium-high, 2–3 per batch, until golden brown all over, 2 minutes per side.

Tools you’ll need

  • 10-inch skillet
  • whisk
  • shallow bowl
  • plate
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.