CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Beef Kroketten

Dutch-style beef croquettes with a golden, crunchy exterior and creamy beef filling. Pan-fried until crispy and served with mustard for dipping.

Total time
25 min
Servings
4
Calories
385
Protein
18g
Crispy Beef Kroketten
comfortindulgentdutchbeefcrispycreamyweeknightdinner

Ingredients

  • ½ lb ground beef
  • 3 tbsp butter
  • 3 tbsp all-purpose flour
  • ½ cup whole milk
  • ¾ cup panko breadcrumbs
  • 1 large egg
  • 2 tbsp dijon mustard

Instructions

  1. 1

    Brown ground beef in a skillet over medium-high, breaking it up as it cooks, until no pink remains, about 5 minutes.

  2. 2

    Melt butter in the same skillet, sprinkle flour over, and stir constantly for 1 minute until it smells nutty.

  3. 3

    Pour milk in slowly while whisking to avoid lumps. Stir in cooked beef and mustard. Cook until thick and pulling from the sides, 2 minutes.

  4. 4

    Spread mixture on a plate and refrigerate for 10 minutes until cool enough to shape.

  5. 5

    Form 8 cylinders from the beef mixture. Beat the egg in a bowl, then roll each cylinder in egg, then in breadcrumbs.

  6. 6

    Pan-fry kroketten in a skillet with oil over medium-high, 2–3 per batch, until golden brown all over, 2 minutes per side.

Tools you’ll need

  • 10-inch skillet
  • whisk
  • shallow bowl
  • plate
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.