Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Beef Pastel

Paper-thin pastry pockets filled with spiced ground beef, pan-fried until golden and shattering. Brazilian street-food energy in 20 minutes.

Total time
20 min
Servings
4
Calories
385
Protein
18g
20-Min Crispy Beef Pastel
casualindulgentbrazilianbeefcrispytenderweeknightgame-day

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Brown ground beef over medium-high heat, breaking it up with a spoon, until no pink remains, ~5 minutes.

  2. Step 2

    Add diced onion and cook, stirring, for 2 minutes until softened and fragrant.

  3. Step 3

    Stir in cumin, hot sauce, and olives. Remove from heat and cool for 1 minute.

  4. Step 4

    Spoon 1 tbsp filling onto the center of each wrapper. Fold in half and seal edges by pressing with a wet fork.

  5. Step 5

    Heat oil in a large skillet over medium-high until it shimmers, ~90 seconds. Working in batches, fry pastels until deep golden brown, ~90 seconds per side.

  6. Step 6

    Transfer to a plate lined with paper towels. Serve hot with lime wedges if desired.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • fork for sealing

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.