CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Cheddar Bean Quesadilla

Warm tortillas stuffed with refried beans and melted cheddar, pan-fried until the edges are golden and crispy. Ready in 10 minutes—serve with salsa, sour cream, and tortilla chips.

Total time
10 min
Servings
2
Calories
420
Protein
14g
Crispy Cheddar Bean Quesadilla
comfortquickamericanvegetariancheesecrispymeltyweeknight

Ingredients

  • 4 tortillas flour tortillas (8-inch)
  • ¾ cup refried beans
  • 1 cup cheddar cheese, shredded

Instructions

  1. 1

    Spread 3 tablespoons refried beans on two tortillas, then top each with half the cheese.

  2. 2

    Place a plain tortilla on top of each bean-cheese stack and press gently to seal.

  3. 3

    Heat a skillet over medium-high until a water droplet sizzles on contact, about 60 seconds.

  4. 4

    Slide one quesadilla into the skillet and cook 2 minutes until the bottom is golden and crispy.

  5. 5

    Flip and cook the other side 90 seconds until the cheese melts and edges are golden.

  6. 6

    Transfer to a cutting board, repeat with the second quesadilla, then cut into wedges and serve.

Tools you’ll need

  • 10-inch skillet
  • cutting board
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.