Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheddar Bean Quesadilla

Warm tortillas stuffed with refried beans and melted cheddar, pan-fried until the edges are golden and crispy. Ready in 10 minutes—serve with salsa, sour cream, and tortilla chips.

Total time
10 min
Servings
2
Calories
420
Protein
14g
Crispy Cheddar Bean Quesadilla
comfortquickamericanvegetariancheesecrispymeltyweeknight

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spread 3 tablespoons refried beans on two tortillas, then top each with half the cheese.

  2. Step 2

    Place a plain tortilla on top of each bean-cheese stack and press gently to seal.

  3. Step 3

    Heat a skillet over medium-high until a water droplet sizzles on contact, about 60 seconds.

  4. Step 4

    Slide one quesadilla into the skillet and cook 2 minutes until the bottom is golden and crispy.

  5. Step 5

    Flip and cook the other side 90 seconds until the cheese melts and edges are golden.

  6. Step 6

    Transfer to a cutting board, repeat with the second quesadilla, then cut into wedges and serve.

Tools you’ll need

  • 10-inch skillet
  • cutting board
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.