Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheese Ball with Dipping Sauces

A Swiss classic—deep-fried cheese and ham nestled in potato, golden and crispy outside, molten inside. Serve with sweet chili and tartar sauce for the ultimate TikTok-worthy finger food.

Total time
20 min
Servings
2
Calories
520
Protein
18g
Crispy Cheese Ball with Dipping Sauces
indulgentfunswissvegetariancheesecrispycreamymelty

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set up three shallow bowls: flour in the first, beaten eggs in the second, mashed potatoes in the third.

  2. Step 2

    Toss cheese cubes in flour to coat lightly, shaking off excess.

  3. Step 3

    Dip each floured cube into egg, then press firmly into mashed potatoes until fully coated.

  4. Step 4

    Heat oil in a heavy pot to 350°F (175°C)—a cube of bread should brown in 60 seconds.

  5. Step 5

    Fry the balls 2–3 minutes until deep golden, turning occasionally so they cook evenly.

  6. Step 6

    Drain on paper towels. Serve immediately with sweet chili and tartar sauce.

Tools you’ll need

  • three shallow bowls
  • heavy pot or Dutch oven
  • instant-read thermometer
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.