Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Malakoff — Swiss Fried Cheese Ball

A showstopping Swiss appetizer: a molten cheese and mushroom ball, breaded and deep-fried until golden and crispy. Serve it hot with crusty bread for dunking.

Total time
28 min
Servings
2
Calories
512
Protein
22g
Crispy Malakoff — Swiss Fried Cheese Ball
indulgentcelebratoryswissvegetariancheesecrispycreamymelty

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a skillet over medium. Sauté shallot for 2 minutes until soft, then add mushrooms and cook 4 minutes until liquid releases and evaporates.

  2. Step 2

    Cool mushroom mixture 3 minutes. Mix with grated cheese and egg yolks in a bowl until a sticky paste forms.

  3. Step 3

    Form mixture into a 2-inch ball. Chill in freezer for 10 minutes until firm enough to handle.

  4. Step 4

    Set up three shallow bowls: flour in one, beaten egg in the second, panko in the third. Roll ball in flour, then egg, then panko until fully coated.

  5. Step 5

    Heat oil in a deep skillet to 350°F (use a thermometer). Slide ball in and fry 3 minutes, turning once, until golden brown on all sides.

  6. Step 6

    Transfer to paper towels. Rest 1 minute, then serve immediately with warm sliced bread.

Tools you’ll need

  • medium skillet
  • deep skillet or small saucepan
  • instant-read thermometer
  • mixing bowl
  • three shallow bowls
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.