CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Malakoff — Swiss Fried Cheese Ball

A showstopping Swiss appetizer: a molten cheese and mushroom ball, breaded and deep-fried until golden and crispy. Serve it hot with crusty bread for dunking.

Total time
28 min
Servings
2
Calories
512
Protein
22g
Crispy Malakoff — Swiss Fried Cheese Ball
indulgentcelebratoryswissvegetariancheesecrispycreamymelty

Ingredients

  • 1 cup Emmental or Gruyère cheese, finely grated
  • 4 oz mushrooms, finely chopped
  • 1 whole shallot, minced
  • 2 whole egg yolks
  • ¾ cup panko breadcrumbs
  • ¼ cup all-purpose flour
  • 1 whole whole egg, beaten (for egg wash)
  • 4 slices sliced bread (for serving)

Instructions

  1. 1

    Heat a skillet over medium. Sauté shallot for 2 minutes until soft, then add mushrooms and cook 4 minutes until liquid releases and evaporates.

  2. 2

    Cool mushroom mixture 3 minutes. Mix with grated cheese and egg yolks in a bowl until a sticky paste forms.

  3. 3

    Form mixture into a 2-inch ball. Chill in freezer for 10 minutes until firm enough to handle.

  4. 4

    Set up three shallow bowls: flour in one, beaten egg in the second, panko in the third. Roll ball in flour, then egg, then panko until fully coated.

  5. 5

    Heat oil in a deep skillet to 350°F (use a thermometer). Slide ball in and fry 3 minutes, turning once, until golden brown on all sides.

  6. 6

    Transfer to paper towels. Rest 1 minute, then serve immediately with warm sliced bread.

Tools you’ll need

  • medium skillet
  • deep skillet or small saucepan
  • instant-read thermometer
  • mixing bowl
  • three shallow bowls
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.