Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheese Tart with Tomatoes & Olives

A Swiss-style cheese tart with a crispy pastry base, melted cheese filling, and bright fresh toppings. Ready in 20 minutes for a weeknight dinner that tastes fancy.

Total time
20 min
Servings
2
Calories
528
Protein
18g
Crispy Cheese Tart with Tomatoes & Olives
comfortsimpleswissvegetariancheesecrispymeltytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line a sheet pan with parchment and lay out the thawed puff pastry.

  2. Step 2

    Brush the pastry edges with beaten egg for a golden finish.

  3. Step 3

    Spread shredded cheese evenly over the pastry, leaving a 0.5-inch border.

  4. Step 4

    Scatter tomato halves and olives across the cheese in an even layer.

  5. Step 5

    Bake 12–14 minutes until the pastry is golden brown and crispy at the edges.

  6. Step 6

    Remove from oven, sprinkle with fresh thyme, slice into 4 pieces, and serve hot.

Tools you’ll need

  • sheet pan
  • parchment paper
  • pastry brush
  • chef's knife
  • cutting board
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.