Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheesy Skillet Hash Browns

Golden, crispy hash browns loaded with melted cheddar cheese and butter. A simple weeknight breakfast that's ready in 15 minutes and tastes like a diner favorite.

Total time
15 min
Servings
2
Calories
380
Protein
8g
Crispy Cheesy Skillet Hash Browns
comfortsimpleamericanvegetariancrispymeltyweeknightbreakfast

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Melt butter in a 10-inch skillet over medium-high heat until foaming.

  2. Step 2

    Add frozen hash browns and cook without stirring for 4 minutes until bottom edges turn golden.

  3. Step 3

    Stir the hash browns, breaking up clumps, then spread in an even layer.

  4. Step 4

    Cook 4 more minutes until all sides are crispy and brown.

  5. Step 5

    Scatter cheddar over the top and cook 1 minute until cheese melts and gets slightly browned.

  6. Step 6

    Serve hot directly from the skillet.

Tools you’ll need

  • 10-inch skillet or cast iron pan
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.