Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheddar Cheese Toast

Golden, buttery toast piled high with melted sharp cheddar. Ready in under 10 minutes—the perfect weeknight snack or light breakfast that feels like comfort food.

Total time
8 min
Servings
2
Calories
385
Protein
15g
Crispy Cheddar Cheese Toast
comfortsimpleamericanvegetariancrispymeltyweeknightsnack

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a skillet or griddle over medium-high until a drop of water sizzles on contact, about 1 minute.

  2. Step 2

    Butter one side of each bread slice generously, then place buttered-side down on the hot skillet.

  3. Step 3

    Toast until the bottom is golden brown and crispy, about 2 minutes without moving.

  4. Step 4

    Flip the toast and immediately pile shredded cheddar on top of each slice.

  5. Step 5

    Cover the skillet with a lid or foil and cook until the cheese melts completely, about 1–2 minutes.

  6. Step 6

    Slide onto a plate and serve hot.

Tools you’ll need

  • 12-inch skillet or griddle
  • butter knife
  • lid or foil

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.