Quick Banh Mi Chicken Sandwich
Crispy Vietnamese-style chicken sandwich with pickled vegetables, fresh herbs, and a kick of mayo. Ready in 20 minutes with store-bought rotisserie chicken or leftover cooked chicken.
- Total time
- 20 min
- Servings
- 2
- Calories
- 540
- Protein
- 38g

casualquickvietnamesechickencrispytendercrunchyMain course
Ingredients
- 2 cups rotisserie chicken or cooked chicken, shredded
- 2 rolls crusty baguette or Vietnamese banh mi roll, halved lengthwise
- 3 tbsp mayonnaise
- 1 tbsp Sriracha or chili paste
- ¾ cup pickled carrots and daikon (from jar) or fresh cucumber, thinly sliced
- ⅓ cup fresh cilantro and mint leaves
- 1 whole lime wedge
Instructions
- 1
Mix mayo and Sriracha in a small bowl until smooth and bright orange.
- 2
Spread chili mayo evenly on the cut sides of the baguette halves.
- 3
Layer shredded chicken on the bottom half, then pile pickled vegetables on top.
- 4
Scatter cilantro and mint leaves over the vegetables.
- 5
Close the sandwich and press gently. Squeeze lime juice over the top.
- 6
Slice in half if desired and serve immediately.
Tools you’ll need
- small bowl
- spoon
- cutting board
- serrated knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



