CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Quick Banh Mi Chicken Sandwich

Crispy Vietnamese-style chicken sandwich with pickled vegetables, fresh herbs, and a kick of mayo. Ready in 20 minutes with store-bought rotisserie chicken or leftover cooked chicken.

Total time
20 min
Servings
2
Calories
540
Protein
38g
Quick Banh Mi Chicken Sandwich
casualquickvietnamesechickencrispytendercrunchyMain course

Ingredients

  • 2 cups rotisserie chicken or cooked chicken, shredded
  • 2 rolls crusty baguette or Vietnamese banh mi roll, halved lengthwise
  • 3 tbsp mayonnaise
  • 1 tbsp Sriracha or chili paste
  • ¾ cup pickled carrots and daikon (from jar) or fresh cucumber, thinly sliced
  • ⅓ cup fresh cilantro and mint leaves
  • 1 whole lime wedge

Instructions

  1. 1

    Mix mayo and Sriracha in a small bowl until smooth and bright orange.

  2. 2

    Spread chili mayo evenly on the cut sides of the baguette halves.

  3. 3

    Layer shredded chicken on the bottom half, then pile pickled vegetables on top.

  4. 4

    Scatter cilantro and mint leaves over the vegetables.

  5. 5

    Close the sandwich and press gently. Squeeze lime juice over the top.

  6. 6

    Slice in half if desired and serve immediately.

Tools you’ll need

  • small bowl
  • spoon
  • cutting board
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.