Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Banh Mi Chicken Sandwich

Crispy Vietnamese-style chicken sandwich with pickled vegetables, fresh herbs, and a kick of mayo. Ready in 20 minutes with store-bought rotisserie chicken or leftover cooked chicken.

Total time
20 min
Servings
2
Calories
540
Protein
38g
Quick Banh Mi Chicken Sandwich
casualquickvietnamesechickencrispytendercrunchyMain course

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix mayo and Sriracha in a small bowl until smooth and bright orange.

  2. Step 2

    Spread chili mayo evenly on the cut sides of the baguette halves.

  3. Step 3

    Layer shredded chicken on the bottom half, then pile pickled vegetables on top.

  4. Step 4

    Scatter cilantro and mint leaves over the vegetables.

  5. Step 5

    Close the sandwich and press gently. Squeeze lime juice over the top.

  6. Step 6

    Slice in half if desired and serve immediately.

Tools you’ll need

  • small bowl
  • spoon
  • cutting board
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.