Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Chicken Crostini

Toasted bread topped with shredded rotisserie chicken, garlic mayo, and fresh herbs—a Tuscan-style appetizer that feels fancy but takes 15 minutes. Serve as a weeknight dinner with a side salad or make a batch for snacking.

Total time
15 min
Servings
4
Calories
385
Protein
22g
Crispy Chicken Crostini
casualfreshitalianchickencrispytenderweeknightappetizer

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice baguette diagonally into 0.5-inch-thick pieces. Arrange on a large skillet over medium heat.

  2. Step 2

    Toast bread 90 seconds per side until golden brown and both sides look crispy.

  3. Step 3

    Stir mayo, lemon juice, half the parsley, and red pepper flakes together in a bowl.

  4. Step 4

    Fold shredded chicken into the mayo mixture until evenly coated.

  5. Step 5

    Spoon chicken mixture generously onto each toasted slice.

  6. Step 6

    Sprinkle remaining parsley on top and serve immediately while bread is still warm.

Tools you’ll need

  • large skillet
  • cutting board
  • serrated knife
  • small mixing bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.