Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Chicken Flautas with Lime Crema

Shredded rotisserie chicken rolled in corn tortillas, pan-fried until golden, and served with a tangy lime crema. A weeknight Tex-Mex plate that tastes like you spent hours—but doesn't.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Crispy Chicken Flautas with Lime Crema
comfortquicktex-mexchickencrispytenderweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Stir sour cream with lime zest, lime juice, and a pinch of salt. Set crema aside.

  2. Step 2

    Warm tortillas in a dry skillet 20 seconds per side so they're pliable without cracking.

  3. Step 3

    Toss shredded chicken with cheddar and jalapeño. Divide evenly among tortillas.

  4. Step 4

    Roll each tortilla tightly around the filling, tucking in the sides. Place seam-side down.

  5. Step 5

    Heat oil in the same skillet over medium-high until it shimmers. Fry flautas 2 minutes per side until golden and crispy.

  6. Step 6

    Serve hot with lime crema on the side or drizzled over top.

Tools you’ll need

  • 9-inch nonstick skillet
  • cutting board
  • knife
  • small bowl (for crema)
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.